Loading...
Statistics
Advertisement

Wwwjs1899.com

Advertisement
Wwwjs1899.com is hosted in Hong Kong / Central District . Wwwjs1899.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/6.0.

Technologies in use by Wwwjs1899.com

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Server Type

  • Microsoft-IIS/6.0

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Wwwjs1899.com

Missing HTTPS protocol.

    Meta - Wwwjs1899.com

    Number of occurences: 1
    • Name:
      Content: 0.1;url=http://www.dafa9099.com/?p=18336

    Server / Hosting

    • IP: 112.213.107.32
    • Latitude: 22.29
    • Longitude: 114.15
    • Country: Hong Kong
    • City: Central District

    Rname

    • dns1.iidns.com
    • dns2.iidns.com
    • dns3.iidns.com
    • dns4.iidns.com
    • dns5.iidns.com
    • dns6.iidns.com

    Target

    • domainadmin.iidns.com

    HTTP Header Response

    HTTP/1.1 200 OK Content-Length: 619 Content-Type: text/html Content-Location: http://www.wwwjs1899.com/index.htm Last-Modified: Thu, 21 Jul 2016 07:57:52 GMT Accept-Ranges: bytes ETag: "ac765f9525e3d11:14a7" Server: Microsoft-IIS/6.0 X-Powered-By: ASP.NET Date: Mon, 05 Sep 2016 05:28:26 GMT X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

    DNS

    host: wwwjs1899.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 112.213.107.32
    host: wwwjs1899.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns1.iidns.com
    host: wwwjs1899.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns2.iidns.com
    host: wwwjs1899.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns3.iidns.com
    host: wwwjs1899.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns4.iidns.com
    host: wwwjs1899.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns5.iidns.com
    host: wwwjs1899.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns6.iidns.com
    host: wwwjs1899.com
    1. class: IN
    2. ttl: 7200
    3. type: SOA
    4. mname: dns1.iidns.com
    5. rname: domainadmin.iidns.com
    6. serial: 1443518867
    7. refresh: 3600
    8. retry: 900
    9. expire: 1209600
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.wwjs1899.com, www.w wwjs1899.com, www. wwjs1899.com, www.wcwwjs1899.com, www.cwwjs1899.com, www.wwwjs1899.com, www.wwjs1899.com, www.wdwwjs1899.com, www.dwwjs1899.com, www.wfwwjs1899.com, www.fwwjs1899.com, www.wgwwjs1899.com, www.gwwjs1899.com, www.wbwwjs1899.com, www.bwwjs1899.com, www.wwjs1899.com, www.ww wjs1899.com, www.w wjs1899.com, www.wwcwjs1899.com, www.wcwjs1899.com, www.wwwjs1899.com, www.wwjs1899.com, www.wwdwjs1899.com, www.wdwjs1899.com, www.wwfwjs1899.com, www.wfwjs1899.com, www.wwgwjs1899.com, www.wgwjs1899.com, www.wwbwjs1899.com, www.wbwjs1899.com, www.wwjs1899.com, www.www js1899.com, www.ww js1899.com, www.wwwcjs1899.com, www.wwcjs1899.com, www.wwwjs1899.com, www.wwjs1899.com, www.wwwdjs1899.com, www.wwdjs1899.com, www.wwwfjs1899.com, www.wwfjs1899.com, www.wwwgjs1899.com, www.wwgjs1899.com, www.wwwbjs1899.com, www.wwbjs1899.com, www.wwws1899.com, www.wwwjzs1899.com, www.wwwzs1899.com, www.wwwjhs1899.com, www.wwwhs1899.com, www.wwwjns1899.com, www.wwwns1899.com, www.wwwj.s1899.com, www.www.s1899.com, www.wwwjus1899.com, www.wwwus1899.com, www.wwwjks1899.com, www.wwwks1899.com, www.wwwjls1899.com, www.wwwls1899.com, www.wwwjos1899.com, www.wwwos1899.com, www.wwwj1899.com, www.wwwjse1899.com, www.wwwje1899.com, www.wwwjsw1899.com, www.wwwjw1899.com, www.wwwjsd1899.com, www.wwwjd1899.com, www.wwwjsx1899.com, www.wwwjx1899.com, www.wwwjsf1899.com, www.wwwjf1899.com, www.wwwjsg1899.com, www.wwwjg1899.com, www.wwwjst1899.com, www.wwwjt1899.com, www.wwwjs899.com, www.wwwjs1l899.com, www.wwwjsl899.com, www.wwwjs10899.com, www.wwwjs0899.com, www.wwwjs19899.com, www.wwwjs9899.com, www.wwwjs199.com, www.wwwjs18y99.com, www.wwwjs1y99.com, www.wwwjs18u99.com, www.wwwjs1u99.com, www.wwwjs18i99.com, www.wwwjs1i99.com, www.wwwjs18699.com, www.wwwjs1699.com, www.wwwjs189.com, www.wwwjs189u9.com, www.wwwjs18u9.com, www.wwwjs189o9.com, www.wwwjs18o9.com, www.wwwjs189i9.com, www.wwwjs18i9.com, www.wwwjs18979.com, www.wwwjs1879.com, www.wwwjs189.com, www.wwwjs1899u.com, www.wwwjs189u.com, www.wwwjs1899o.com, www.wwwjs189o.com, www.wwwjs1899i.com, www.wwwjs189i.com, www.wwwjs18997.com, www.wwwjs1897.com,

    Other websites we recently analyzed

    1. rostocker-fruehling – Initiative für Demokratie und Umweltschutz
      diese website ist grad in Überarbeitung ...   Rettet die Natur in den Wall-Anlagen vor den Umbauten! Liebe Freundinnen und Freunde des rostocker frühling, kommt alle zum Bürgerforum zum Thema Wallanlagen: die Planungen zur Dreiwallbastion und zur Heubastion werden vorgestellt und diskutiert: am Dienstag, 11. August 2015, um 17:00 Uhr, im Kulturhistorischen Museum, im Kapitelsaal.…
      San Francisco (United States) - 192.0.78.13
      Server software: Apache
      Technology: Skimlinks, CSS, Google Font API, Gravatar, Html, Html5, Javascript, Php, Pingback, comScore, Wordpress
      Number of Javascript: 6
      Number of meta tags: 12
    2. Get Money Empire Inc. - Home
      San Francisco (United States) - 199.34.228.68
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 5
      Number of meta tags: 1
    3. vuki.science
      Austin (United States) - 209.99.40.219
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    4. Huron Valley Cabling and Consulting
      Business for Telephone and Computer Cabling
      Mountain View (United States) - 74.125.206.121
      Server software: ghs
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 3
    5. physiciansadvancedfitnessmedicine.com
      Provo (United States) - 198.57.247.164
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 2
    6. Sie werden weitergeleitet auf
      Germany - 134.119.245.118
      Server software: Apache/2.4.20
      Technology: Php
      Number of meta tags: 1
    7. lifestyle-urlaub
      Germany - 91.198.157.170
      G Analytics ID: UA-9440081-33
      Server software: Apache/2.2.21 (Win32) PHP/5.3.8 mod_perl/2.0.4 Perl/v5.10.1
      Technology: Html, Google Analytics
      Number of meta tags: 3
    8. czxtx.com
      Hong Kong - 103.61.240.87
      Server software: Microsoft-IIS/6.0
      Technology: Html, Html5, Javascript
      Number of meta tags: 1
    9. orangesunteamwear.net
      Switzerland - 141.8.224.25
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    10. Affordable Car Care Auto Repair Walton Hills Ohio
      Affordable Car Care is a family owned business delivering honest & professional auto repair & maintenance services to the people of Walton Hills, Macedonia, Sagamore Hills, Northfield, Solon, and surrounding areas.
      Phoenix (United States) - 69.50.216.99
      Server software: Apache
      Technology: CSS, Html, Javascript, Share This Social Media Buttons
      Number of Javascript: 4
      Number of meta tags: 4

    Check Other Websites